PDB entry 1f95

View 1f95 on RCSB PDB site
Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex
Class: CONTRACTILE PROTEIN/peptide
Keywords: dynein, light chain, DLC8, Bim, APOPTOSIS, CONTRACTILE PROTEIN-peptide complex
Deposited on 2000-07-07, released 2001-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dynein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOPe 2.08: d1f95a_
• Chain 'B':
  Compound: dynein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOPe 2.08: d1f95b_
• Chain 'C':
  Compound: bcl2-like 11 (apoptosis facilitator)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43521 (0-8)
• Chain 'D':
  Compound: bcl2-like 11 (apoptosis facilitator)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43521 (0-8)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f95A (A:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f95B (B:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.