PDB entry 1f94

View 1f94 on RCSB PDB site
Description: the 0.97 resolution structure of bucandin, a novel toxin isolated from the malayan krait
Class: toxin
Keywords: three-finger snake presynaptic neurotoxin, TOXIN
Deposited on 2000-07-06, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bucandin
  Species: Bungarus candidus [TaxId:92438]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81782 (0-62)
  Domains in SCOPe 2.08: d1f94a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f94A (A:)
  mecyrcgvsgchlkitcsaeetfcykwlnkisnerwlgcaktcteidtwnvynkccttnl
  cnt