PDB entry 1f93

View 1f93 on RCSB PDB site
Description: crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Deposited on 2000-07-06, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f93a_
  • Chain 'B':
    Domains in SCOP 1.55: d1f93b_
  • Chain 'C':
    Domains in SCOP 1.55: d1f93c_
  • Chain 'D':
    Domains in SCOP 1.55: d1f93d_
  • Chain 'E':
    Domains in SCOP 1.55: d1f93e_
  • Chain 'F':
    Domains in SCOP 1.55: d1f93f_
  • Chain 'G':
    Domains in SCOP 1.55: d1f93g_
  • Chain 'H':
    Domains in SCOP 1.55: d1f93h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93A (A:)
    agkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekld
    hhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93B (B:)
    ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
    ewfnvynkvhitlsthecaglserdinlasfieqvavsm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93C (C:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93D (D:)
    ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
    ewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93E (E:)
    mvsklsqlqtellaallesglskealiqalg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93F (F:)
    lsqlqtellaallesglskealiqalg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93G (G:)
    klsqlqtellaallesglskealiqal
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f93H (H:)
    lsqlqtellaallesglskealiqal