PDB entry 1f93

View 1f93 on RCSB PDB site
Description: crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Class: transcription
Keywords: four-helix bundle, transcriptional activator/coactivator complex, dimerization domain
Deposited on 2000-07-06, released 2000-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dimerization cofactor of hepatocyte nuclear factor 1-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61459 (Start-103)
      • modified residue (49)
      • modified residue (102)
    Domains in SCOPe 2.06: d1f93a_
  • Chain 'B':
    Compound: dimerization cofactor of hepatocyte nuclear factor 1-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61459
      • modified residue (49)
      • modified residue (102)
    Domains in SCOPe 2.06: d1f93b_
  • Chain 'C':
    Compound: dimerization cofactor of hepatocyte nuclear factor 1-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61459 (Start-103)
      • modified residue (49)
      • modified residue (102)
    Domains in SCOPe 2.06: d1f93c_
  • Chain 'D':
    Compound: dimerization cofactor of hepatocyte nuclear factor 1-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61459 (Start-103)
      • modified residue (49)
      • modified residue (102)
    Domains in SCOPe 2.06: d1f93d_
  • Chain 'E':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f93e_
  • Chain 'F':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f93f_
  • Chain 'G':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f93g_
  • Chain 'H':
    Compound: hepatocyte nuclear factor 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f93h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f93A (A:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93A (A:)
    agkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekld
    hhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f93B (B:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93B (B:)
    ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
    ewfnvynkvhitlsthecaglserdinlasfieqvavsm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f93C (C:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93C (C:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f93D (D:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93D (D:)
    ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
    ewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f93E (E:)
    mvsklsqlqtellaallesglskealiqalge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93E (E:)
    mvsklsqlqtellaallesglskealiqalg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f93F (F:)
    mvsklsqlqtellaallesglskealiqalge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93F (F:)
    lsqlqtellaallesglskealiqalg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f93G (G:)
    mvsklsqlqtellaallesglskealiqalge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93G (G:)
    klsqlqtellaallesglskealiqal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f93H (H:)
    mvsklsqlqtellaallesglskealiqalge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f93H (H:)
    lsqlqtellaallesglskealiqal