PDB entry 1f90

View 1f90 on RCSB PDB site
Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
Class: immune system
Keywords: monoclonal antibody, antigen-binding fragment, interleukin-2, antigenic peptide
Deposited on 2000-07-06, released 2001-07-11
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.165
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: antigenic nonapeptide
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: fab fragment of monoclonal antibody
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1f90h1, d1f90h2
  • Chain 'L':
    Compound: fab fragment of monoclonal antibody
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1f90l1, d1f90l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f90H (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f90L (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec