PDB entry 1f8z

View 1f8z on RCSB PDB site
Description: nmr structure of the sixth ligand-binding module of the ldl receptor
Class: lipid binding protein
Keywords: LDL receptor, ligand-binding domain, calcium-binding, familial hypercholesterolemia, LIPID BINDING PROTEIN
Deposited on 2000-07-05, released 2000-10-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: low-density lipoprotein receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01130 (0-38)
  Domains in SCOPe 2.04: d1f8za_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f8zA (A:)
  atcrpdefqcsdgncihgsrqcdreydckdmsdevgcvn