PDB entry 1f8z

View 1f8z on RCSB PDB site
Description: nmr structure of the sixth ligand-binding module of the ldl receptor
Class: lipid binding protein
Keywords: LDL receptor, ligand-binding domain, calcium-binding, familial hypercholesterolemia, LIPID BINDING PROTEIN
Deposited on 2000-07-05, released 2000-10-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low-density lipoprotein receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1f8za_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8zA (A:)
    atcrpdefqcsdgncihgsrqcdreydckdmsdevgcvn