PDB entry 1f8y

View 1f8y on RCSB PDB site
Description: crystal structure analysis of nucleoside 2-deoxyribosyltransferase complexed with 5-methyl-2'-deoxypseudouridine
Deposited on 2000-07-05, released 2000-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f8ya_
  • Chain 'B':
    Domains in SCOP 1.55: d1f8yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8yA (A:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8yB (B:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy