PDB entry 1f8x

View 1f8x on RCSB PDB site
Description: crystal structure of nucleoside 2-deoxyribosyltransferase
Deposited on 2000-07-05, released 2000-07-26
The last revision prior to the SCOP 1.67 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f8xa_
  • Chain 'B':
    Domains in SCOP 1.67: d1f8xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8xA (A:)
    mpkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylh
    dkvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygk
    pinlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8xA (A:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8xB (B:)
    mpkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylh
    dkvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygk
    pinlmswgvsdnvikmsqlkdfnfnkprfdfyegavy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8xB (B:)
    pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
    kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
    inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy