PDB entry 1f8w

View 1f8w on RCSB PDB site
Description: crystal structure of nadh peroxidase mutant: r303m
Deposited on 2000-07-05, released 2001-02-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-05, with a file datestamp of 2001-02-05.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8wA (A:)
    mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
    mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
    pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
    ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
    avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
    namkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
    dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
    dfffqpafdkpwniintaaleavkqer