PDB entry 1f8t

View 1f8t on RCSB PDB site
Description: fab (lnkb-2) of monoclonal antibody, crystal structure
Class: immune system
Keywords: monoclonal antibody, antigen-binding fragment, interleukin-2, x-ray analysis, crystal
Deposited on 2000-07-05, released 2001-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody fab fragment (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1f8th1, d1f8th2
  • Chain 'L':
    Compound: antibody fab fragment (light chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1f8tl1, d1f8tl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8tH (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8tL (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec