PDB entry 1f8t

View 1f8t on RCSB PDB site
Description:
Deposited on 2000-07-05, released 2001-07-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-07-05, with a file datestamp of 2001-07-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1f8th1, d1f8th2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1f8tl1, d1f8tl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8tH (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8tL (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec