PDB entry 1f8s

View 1f8s on RCSB PDB site
Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
Deposited on 2000-07-04, released 2000-08-24
The last revision prior to the SCOP 1.71 freeze date was dated 2000-08-24, with a file datestamp of 2000-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8sA (A:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sA (A:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8sB (B:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sB (B:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f8sC (C:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sC (C:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f8sD (D:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sD (D:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f8sE (E:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sE (E:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f8sF (F:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sF (F:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f8sG (G:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sG (G:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f8sH (H:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8sH (H:)
    nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
    serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
    nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
    tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
    tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
    nppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftn
    gvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldk
    yamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnlas
    en