PDB entry 1f8r

View 1f8r on RCSB PDB site
Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
Deposited on 2000-07-04, released 2000-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2000-08-24, with a file datestamp of 2000-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8rA (A:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8rA (A:)
    rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
    aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
    knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
    stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
    ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
    fnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnft
    ngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsld
    kyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnla
    sen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8rB (B:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8rB (B:)
    rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
    aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
    knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
    stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
    ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
    fnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnft
    ngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsld
    kyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnla
    sen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f8rC (C:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8rC (C:)
    rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
    aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
    knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
    stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
    ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
    fnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnft
    ngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsld
    kyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnla
    sen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f8rD (D:)
    addrnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvt
    vleaserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnaw
    yfiknirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnky
    dtystkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgm
    dklptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravr
    likfnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnh
    nftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkw
    sldkyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardv
    nlasenpsgihlsndnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8rD (D:)
    rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
    aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
    knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
    stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
    ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
    fnppllpkkahalrsvhyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnft
    ngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsld
    kyamggittftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglraardvnla
    sen