PDB entry 1f8q

View 1f8q on RCSB PDB site
Description: crystal structure of alpha-momorcharin in acetonitrile-water mixture
Deposited on 2000-07-03, released 2000-07-26
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f8qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8qA (A:)
    dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
    tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
    prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
    lntrni