PDB entry 1f8n

View 1f8n on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 100k, new refinement
Class: oxidoreductase
Keywords: dioxygenase, lipoxygenase, metalloprotein, fatty acids, oxidoreductase
Deposited on 2000-06-30, released 2001-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.198
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f8na1, d1f8na2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8nA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8nA (A:)
    hkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
    esafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvr
    iffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdksekl
    arpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtks
    lsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdg
    qhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqss
    kitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredg
    tlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwl
    nthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpsk
    ysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaai
    ktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcli
    iiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsk
    lptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnn
    dpslqgnrlgpvqlpytllypsseegltfrgipnsisi