PDB entry 1f8m

View 1f8m on RCSB PDB site
Description: crystal structure of 3-bromopyruvate modified isocitrate lyase (icl) from mycobacterium tuberculosis
Class: lyase
Keywords: Alpha-beta barrel, Helix-swapping, closed conformation, bromopyuvate modification, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LYASE
Deposited on 2000-06-30, released 2000-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate lyase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5H3
      • insertion (1)
    Domains in SCOPe 2.07: d1f8ma_
  • Chain 'B':
    Compound: isocitrate lyase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5H3
      • insertion (1)
    Domains in SCOPe 2.07: d1f8mb_
  • Chain 'C':
    Compound: isocitrate lyase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5H3
      • insertion (1)
    Domains in SCOPe 2.07: d1f8mc_
  • Chain 'D':
    Compound: isocitrate lyase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5H3
      • insertion (1)
    Domains in SCOPe 2.07: d1f8md_
  • Heterogens: MG, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f8mA (A:)
    masvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweq
    lhdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpq
    vvrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvags
    hwedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlits
    dvderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfse
    avkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmf
    dlaygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttalt
    gsteegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8mA (A:)
    asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8mB (B:)
    masvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweq
    lhdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpq
    vvrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvags
    hwedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlits
    dvderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfse
    avkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmf
    dlaygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttalt
    gsteegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8mB (B:)
    asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f8mC (C:)
    masvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweq
    lhdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpq
    vvrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvags
    hwedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlits
    dvderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfse
    avkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmf
    dlaygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttalt
    gsteegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8mC (C:)
    asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f8mD (D:)
    masvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweq
    lhdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpq
    vvrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvags
    hwedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlits
    dvderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfse
    avkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmf
    dlaygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttalt
    gsteegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8mD (D:)
    asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf