PDB entry 1f8h

View 1f8h on RCSB PDB site
Description: structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr
Deposited on 2000-06-30, released 2000-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f8ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8hA (A:)
    pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
    drdefavamflvycalekepvpmslppalvppskr