PDB entry 1f8h

View 1f8h on RCSB PDB site
Description: structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr
Class: endocytosis/exocytosis
Keywords: complex, eh domain, npf, calcium binding, signaling domain, ef-hand, endocytosis/exocytosis complex
Deposited on 2000-06-30, released 2000-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor receptor substrate 15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f8ha_
  • Chain 'B':
    Compound: ptgssstnpfr
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F8H (Start-10)
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f8hA (A:)
pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
drdefavamflvycalekepvpmslppalvppskr

  • Chain 'B':
    No sequence available.