PDB entry 1f8b

View 1f8b on RCSB PDB site
Description: Native Influenza Virus Neuraminidase in Complex with NEU5AC2EN
Class: hydrolase/hydrolase inhibitor
Keywords: neuraminidase, hydrolase, influenza protein, glycosylated protein, DANA, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-06-30, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:384509]
    Database cross-references and differences (RAF-indexed):
    • GB AAA43574 (0-387)
      • conflict (294)
      • conflict (304-305)
    Domains in SCOPe 2.07: d1f8ba_
  • Heterogens: NAG, CA, DAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f8bA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl