PDB entry 1f8a

View 1f8a on RCSB PDB site
Description: structural basis for the phosphoserine-proline recognition by group IV ww domains
Class: isomerase
Keywords: Peptidyl-Proline Isomerase, WW domain, phosphoserine binding, ISOMERASE
Deposited on 2000-06-29, released 2000-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (4-166)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1f8ab1, d1f8ab2, d1f8ab3
  • Chain 'C':
    Compound: y(sep)pt(sep)s peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F8A (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f8aB (B:)
    gshgmadeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvr
    cshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssa
    kargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f8aB (B:)
    gshgmadeeklppgwekrmsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsr
    rpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrg
    qmqkpfedasfalrtgemsgpvftdsgihiilrte
    

  • Chain 'C':
    No sequence available.