PDB entry 1f86

View 1f86 on RCSB PDB site
Description: transthyretin thr119met protein stabilisation
Class: transport protein
Keywords: transthyretin, protein stability, X-ray crystal structure, amyloidogenesis, TRANSPORT PROTEIN
Deposited on 2000-06-29, released 2001-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.14
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transthyretin thr119met variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-114)
      • engineered (109)
    Domains in SCOPe 2.06: d1f86a_
  • Chain 'B':
    Compound: transthyretin thr119met variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-114)
      • engineered (109)
    Domains in SCOPe 2.06: d1f86b_
  • Heterogens: T44, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f86A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f86B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn