PDB entry 1f83

View 1f83 on RCSB PDB site
Description: botulinum neurotoxin type b catalytic domain with synaptobrevin-ii bound
Deposited on 2000-06-28, released 2000-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f83a_
  • Chain 'B':
    Domains in SCOP 1.55: d1f83b_
  • Chain 'C':
    Domains in SCOP 1.55: d1f83c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f83A (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeisk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.