PDB entry 1f80

View 1f80 on RCSB PDB site
Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Class: transferase
Keywords: 9-strand pseudo beta barrel holo-(acyl carrier protein) acp holo-(acyl carrier protein) synthase acps, TRANSFERASE
Deposited on 2000-06-28, released 2001-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holo-(acyl carrier protein) synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96618 (0-End)
      • engineered (0)
    Domains in SCOPe 2.06: d1f80a_
  • Chain 'B':
    Compound: holo-(acyl carrier protein) synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96618 (0-End)
      • engineered (0)
    Domains in SCOPe 2.06: d1f80b_
  • Chain 'C':
    Compound: holo-(acyl carrier protein) synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f80c_
  • Chain 'D':
    Compound: Acyl carrier protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80643 (5-End)
      • see remark 999 (4)
    Domains in SCOPe 2.06: d1f80d1, d1f80d2
  • Chain 'E':
    Compound: Acyl carrier protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f80e_
  • Chain 'F':
    Compound: Acyl carrier protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f80f_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f80A (A:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80A (A:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f80B (B:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80B (B:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f80C (C:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80C (C:)
    ygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafsk
    afgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvier
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f80D (D:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80D (D:)
    sadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdeda
    ekiatvgdavnyiq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f80E (E:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80E (E:)
    adtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdedae
    kiatvgdavnyiqn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f80F (F:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80F (F:)
    adtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdedae
    kiatvgdavnyiq