PDB entry 1f80

View 1f80 on RCSB PDB site
Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Deposited on 2000-06-28, released 2001-06-28
The last revision prior to the SCOP 1.67 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f80a_
  • Chain 'B':
    Domains in SCOP 1.67: d1f80b_
  • Chain 'C':
    Domains in SCOP 1.67: d1f80c_
  • Chain 'D':
    Domains in SCOP 1.67: d1f80d_
  • Chain 'E':
    Domains in SCOP 1.67: d1f80e_
  • Chain 'F':
    Domains in SCOP 1.67: d1f80f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f80A (A:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80A (A:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f80B (B:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80B (B:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f80C (C:)
    aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
    kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80C (C:)
    ygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafsk
    afgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvier
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f80D (D:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80D (D:)
    sadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdeda
    ekiatvgdavnyiq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f80E (E:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80E (E:)
    adtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdedae
    kiatvgdavnyiqn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f80F (F:)
    gplgsadtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeis
    dedaekiatvgdavnyiqnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f80F (F:)
    adtlervtkiivdrlgvdeadvkleasfkedlgadxldvvelvmeledefdmeisdedae
    kiatvgdavnyiq