PDB entry 1f7z

View 1f7z on RCSB PDB site
Description: rat trypsinogen k15a complexed with bovine pancreatic trypsin inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, trypsin precursor, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-06-28, released 2001-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.199
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f7za_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f7zi_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f7zA (A:)
    eafpvddddaivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrl
    gehninvlegneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpssca
    pagtqclisgwgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggk
    dscqgdsggpvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f7zA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelqgi
    vswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1f7zI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggaig
    pwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f7zI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg