PDB entry 1f7y

View 1f7y on RCSB PDB site
Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Deposited on 2000-06-28, released 2000-11-22
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f7ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1f7yA (A:)
mpitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
gqrrrllrylqredperyrmlieklgirg

    Sequence, based on observed residues (ATOM records): (download) 
    >1f7yA (A:)
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi