PDB entry 1f7x

View 1f7x on RCSB PDB site
Description: solution structure of c-terminal domain zipa
Class: cell cycle
Keywords: Alpha-Beta fold, cell division, septation, transmembrane, inner membrane
Deposited on 2000-06-28, released 2001-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2001-06-28, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein zipa
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f7xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f7xA (A:)
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana