PDB entry 1f7u

View 1f7u on RCSB PDB site
Description: crystal structure of the arginyl-trna synthetase complexed with the trna(arg) and l-arg
Deposited on 2000-06-28, released 2001-06-27
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f7uA (A:)
    astanmisqlkklsiaepavakdshpdvnivdlmrnyisqelskisgvdsslifpalewt
    ntmergdllipiprlrikganpkdlavqwaekfpcgdflekveangpfiqfffnpqflak
    lvipdiltrkedygscklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgw
    evirmnylgdwgkqfgllavgferygneealvkdpihhlfdvyvrinkdieeegdsiple
    qstngkareyfkrmedgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskes
    mlkaidlfkekglthedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryek
    yhfdkmiyviasqqdlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldni
    leetkekmhevmkknenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsf
    egdtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrna
    ikthepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgl
    tpverm