PDB entry 1f75

View 1f75 on RCSB PDB site
Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26
Deposited on 2000-06-26, released 2001-03-28
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f75a_
  • Chain 'B':
    Domains in SCOP 1.57: d1f75b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f75A (A:)
    ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
    stenwsrpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakek
    tkhntgltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpe
    llirtsgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f75A (A:)
    ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
    nylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfa
    lnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerls
    nfliwqcsysefvfidefwpdfneeslaqcisiyqnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f75B (B:)
    qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafstenw
    srpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhnt
    gltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirt
    sgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f75B (B:)
    qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafnylmk
    lpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfalnygg
    rkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerlsnfliw
    qcsysefvfidefwpdfneeslaqcisiyqnr