PDB entry 1f6y

View 1f6y on RCSB PDB site
Description: mad crystal structure analysis of methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase (metr)
Class: transferase
Keywords: carbon dioxide fixation, cobalamin, methyltatrahydrofolate, methyltransferase, one-carbon metabolism, TIM barrel, homodimer, TRANSFERASE
Deposited on 2000-06-23, released 2000-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase
    Species: Moorella thermoacetica [TaxId:264732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6ya_
  • Chain 'B':
    Compound: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase
    Species: Moorella thermoacetica [TaxId:264732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6yb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f6yA (A:)
    mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
    vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
    gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
    qqikmladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaa
    taeillnqtvycdsfvkmfktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6yA (A:)
    mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgdkvsamewlvevt
    qevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaaligltm
    nktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktlqqik
    mladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaataei
    llnqtvycdsfvkmfktr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6yB (B:)
    mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
    vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
    gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
    qqikmladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaa
    taeillnqtvycdsfvkmfktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6yB (B:)
    mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgdkvsamewlvevt
    qevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaaligltm
    nktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktlqqik
    mladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaataei
    llnqtvycdsfvkmfktr