PDB entry 1f6u

View 1f6u on RCSB PDB site
Description: NMR structure of the HIV-1 nucleocapsid protein bound to stem-loop sl2 of the psi-RNA packaging signal. Implications for genome recognition
Class: structural protein/RNA
Keywords: hiv-1, RNA, protein-RNA complex, nmr, packaging signal, structural protein/RNA complex
Deposited on 2000-06-23, released 2000-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 nucleocapsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35962 (0-54)
      • conflict (2)
    Domains in SCOPe 2.07: d1f6ua_
  • Chain 'B':
    Compound: hiv-1 stem-loop sl2 from psi-RNA packaging
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6uA (A:)
    mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan
    

  • Chain 'B':
    No sequence available.