PDB entry 1f6u

View 1f6u on RCSB PDB site
Description: nmr structure of the hiv-1 nucleocapsid protein bound to stem-loop sl2 of the psi-rna packaging signal. implications for genome recognition
Deposited on 2000-06-23, released 2000-10-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-09, with a file datestamp of 2000-10-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f6ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6uA (A:)
    mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan