PDB entry 1f6l

View 1f6l on RCSB PDB site
Description: variable light chain dimer of anti-ferritin antibody
Class: immune system
Keywords: immunoglobulin fold, variable light chain, dimer, anti-ferritin antibody, IMMUNE SYSTEM
Deposited on 2000-06-22, released 2002-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: anti-ferritin immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f6ll_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1f6lL (L:)
    diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtkleikrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6lL (L:)
    diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtklei