PDB entry 1f6l

View 1f6l on RCSB PDB site
Description:
Deposited on 2000-06-22, released 2002-10-23
The last revision prior to the SCOP 1.67 freeze date was dated 2002-10-23, with a file datestamp of 2002-10-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1f6ll_

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1f6lL (L:)
    diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtkleikrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6lL (L:)
    diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtklei