PDB entry 1f6h

View 1f6h on RCSB PDB site
Description: combined rietveld and stereochemical restraint refinement of a protein
Deposited on 2000-06-21, released 2000-07-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: X-RAYPOWDERDIFFRACTION
Resolution: 3.31 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f6ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6hA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg