PDB entry 1f6h

View 1f6h on RCSB PDB site
Description: combined rietveld and stereochemical restraint refinement of a protein
Class: oxygen storage/transport
Keywords: powder diffraction, rietveld refinement, myoblobin(met), oxygen storage/transport complex
Deposited on 2000-06-21, released 2000-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: PDIF
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myoglobin (met)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6ha_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6hA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg