PDB entry 1f6g

View 1f6g on RCSB PDB site
Description: potassium channel (kcsa) full-length fold
Class: proton transport, membrane protein
Keywords: potassium channel, integral membrane protein, cytoplasmic domains, proton transport, membrane protein
Deposited on 2000-06-21, released 2001-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-159)
      • conflict (26)
      • conflict (63)
      • engineered (89)
    Domains in SCOPe 2.06: d1f6ga_
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-159)
      • conflict (26)
      • conflict (63)
      • engineered (89)
    Domains in SCOPe 2.06: d1f6gb_
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-159)
      • conflict (26)
      • conflict (63)
      • engineered (89)
    Domains in SCOPe 2.06: d1f6gc_
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-159)
      • conflict (26)
      • conflict (63)
      • engineered (89)
    Domains in SCOPe 2.06: d1f6gd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6gA (A:)
    mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
    typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghfvrhsekaaeeaytrttralherfdrlermlddnrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6gB (B:)
    mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
    typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghfvrhsekaaeeaytrttralherfdrlermlddnrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6gC (C:)
    mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
    typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghfvrhsekaaeeaytrttralherfdrlermlddnrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6gD (D:)
    mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
    typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghfvrhsekaaeeaytrttralherfdrlermlddnrr