PDB entry 1f6f

View 1f6f on RCSB PDB site
Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor
Class: hormone/growth factor/hormone receptor
Keywords: 4-helical bundle, alpha helical bundle, ternary complex, FN III domains, beta sheet domains, cytokine-receptor complex, HORMONE/GROWTH FACTOR/HORMONE RECEPTOR COMPLEX
Deposited on 2000-06-21, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: placental lactogen
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6fa_
  • Chain 'B':
    Compound: Prolactin receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6fb1, d1f6fb2
  • Chain 'C':
    Compound: Prolactin receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f6fc1, d1f6fc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f6fA (A:)
    aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqygqginseskvinc
    htssittpnskaeaintedkilfklvisllhswdeplhhavtelanskgtspalltkaqe
    ikekakvlvdgveviqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrds
    skiytylrilkcrltscet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6fA (A:)
    aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqyvinchtssittpn
    skaeaintedkilfklvisllhswdeplhhavtelanpalltkaqeikekakvlvdgvev
    iqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrdsskiytylrilkcrl
    tsc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6fB (B:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqlkdkk
    tylwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylv
    qtrckpdhgywsrwsqessvempndftlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6fB (B:)
    gkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpnscff
    skqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkkktylwvkws
    pptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylvqtrckpdh
    gywsrwsqessvemp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f6fC (C:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqlkdkk
    tylwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylv
    qtrckpdhgywsrwsqessvempndftlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6fC (C:)
    kpeihkcrspdketftcwwnpgttnysltyskegekttyecpdyktsgpnscffskqyts
    iwkiyiitvnatsssdplyvdvtyivepepprnltlevkktylwvkwspptmeyeirlke
    weihftghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvempn