PDB entry 1f6d

View 1f6d on RCSB PDB site
Description: the structure of udp-n-acetylglucosamine 2-epimerase from e. coli.
Deposited on 2000-06-21, released 2000-12-13
The last revision prior to the SCOP 1.65 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1f6da_
  • Chain 'B':
    Domains in SCOP 1.65: d1f6db_
  • Chain 'C':
    Domains in SCOP 1.65: d1f6dc_
  • Chain 'D':
    Domains in SCOP 1.65: d1f6dd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6dA (A:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6dB (B:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6dB (B:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    qglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtgd
    lyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdqv
    mssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiqivyp
    vhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpv
    lvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsr
    ilealknnrisl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f6dC (C:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6dC (C:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    gqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtg
    dlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdq
    vmssdklrselaanypfidpdkkmilvtghrfgrgfeeichaladiatthqdiqivypvh
    lnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpvlv
    mrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsril
    ealknnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f6dD (D:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6dD (D:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnri