PDB entry 1f68

View 1f68 on RCSB PDB site
Description: nmr solution structure of the bromodomain from human gcn5
Class: transferase
Keywords: left-handed four-helix bundle, transferase
Deposited on 2000-06-20, released 2000-12-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92830 (0-102)
      • engineered (0)
    Domains in SCOPe 2.02: d1f68a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f68A (A:)
    gdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvt
    rklfvadlqrviancreynppdseycrcasalekffyfklkeg