PDB entry 1f68

View 1f68 on RCSB PDB site
Description: nmr solution structure of the bromodomain from human gcn5
Deposited on 2000-06-20, released 2000-12-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f68a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f68A (A:)
    gdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvt
    rklfvadlqrviancreynppdseycrcasalekffyfklkeg