PDB entry 1f66

View 1f66 on RCSB PDB site
Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Deposited on 2000-06-20, released 2000-11-27
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-27, with a file datestamp of 2000-11-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f66a_
  • Chain 'B':
    Domains in SCOP 1.71: d1f66b_
  • Chain 'C':
    Domains in SCOP 1.71: d1f66c_
  • Chain 'D':
    Domains in SCOP 1.71: d1f66d_
  • Chain 'E':
    Domains in SCOP 1.71: d1f66e_
  • Chain 'F':
    Domains in SCOP 1.71: d1f66f_
  • Chain 'G':
    Domains in SCOP 1.71: d1f66g_
  • Chain 'H':
    Domains in SCOP 1.71: d1f66h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f66A (A:)
    martkqtarkstggkaprkqlatkaarksapatgevkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66A (A:)
    kkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqea
    seaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f66B (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66B (B:)
    rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
    amdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f66C (C:)
    maggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaile
    yltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihkslig
    kkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66C (C:)
    avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
    lkvkritprhlqlairgdeeldslikatiagggviphihksli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f66D (D:)
    mpepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskam
    simnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66D (D:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f66E (E:)
    martkqtarkstggkaprkqlatkaarksapatgevkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66E (E:)
    gevkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
    qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f66F (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66F (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f66G (G:)
    maggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaile
    yltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihkslig
    kkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66G (G:)
    avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
    lkvkritprhlqlairgdeeldslikatiagggviphihksligkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f66H (H:)
    mpepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskam
    simnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66H (H:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak