PDB entry 1f66

View 1f66 on RCSB PDB site
Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Class: structural protein/DNA
Keywords: nucleosome, chromatin, histone, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA), structural protein/DNA complex
Deposited on 2000-06-20, released 2000-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT64
      • conflict (117)
    Domains in SCOPe 2.07: d1f66a_
  • Chain 'B':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f66b_
  • Chain 'C':
    Compound: histone h2a.z
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f66c_
  • Chain 'D':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • conflict (32)
    Domains in SCOPe 2.07: d1f66d_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT64 (Start-35)
      • conflict (34)
      • conflict (117)
    Domains in SCOPe 2.07: d1f66e_
  • Chain 'F':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f66f_
  • Chain 'G':
    Compound: histone h2a.z
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f66g_
  • Chain 'H':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-125)
      • conflict (32)
    Domains in SCOPe 2.07: d1f66h_
  • Chain 'I':
    Compound: palindromic 146 base pair DNA fragment
  • Chain 'J':
    Compound: palindromic 146 base pair DNA fragment
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f66A (A:)
    martkqtarkstggkaprkqlatkaarksapatgevkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66A (A:)
    kkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqea
    seaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f66B (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66B (B:)
    rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
    amdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f66C (C:)
    maggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaile
    yltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihkslig
    kkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66C (C:)
    avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
    lkvkritprhlqlairgdeeldslikatiagggviphihksli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f66D (D:)
    mpepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskam
    simnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66D (D:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f66E (E:)
    martkqtarkstggkaprkqlatkaarksapatgevkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66E (E:)
    gevkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
    qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f66F (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66F (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f66G (G:)
    maggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaile
    yltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihkslig
    kkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66G (G:)
    avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
    lkvkritprhlqlairgdeeldslikatiagggviphihksligkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f66H (H:)
    mpepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskam
    simnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f66H (H:)
    ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.