PDB entry 1f60

View 1f60 on RCSB PDB site
Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
Class: translation
Keywords: protein-protein complex, TRANSLATION
Deposited on 2000-06-19, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.189
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor eef1a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f60a1, d1f60a2, d1f60a3
  • Chain 'B':
    Compound: elongation factor eef1ba
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f60b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f60A (A:)
    mgkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvl
    dklkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggv
    gefeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvg
    ynpktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
    dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
    vpgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvld
    chtahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplg
    rfavrdmrqtvavgviksvdktekaakvtkaaqkaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f60A (A:)
    gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
    klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
    efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
    npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptd
    kplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgv
    pgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldc
    htahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgr
    favrdmrqtvavgviksvdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f60B (B:)
    kpakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqinc
    vveddkvslddlqqsieededhvqstdiaamqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f60B (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl