PDB entry 1f5y

View 1f5y on RCSB PDB site
Description: nmr structure of a concatemer of the first and second ligand-binding modules of the human ldl receptor
Class: lipid binding protein
Keywords: Beta hairpin, 3-10 helix, calcium binding, LIPID BINDING PROTEIN
Deposited on 2000-06-18, released 2000-08-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: low-density lipoprotein receptor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01130 (2-84)
    • cloning artifact (0-1)
  Domains in SCOPe 2.01: d1f5ya1, d1f5ya2
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f5yA (A:)
  gsavgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvtcksgdfscggrv
  nrcipqfwrcdgqvdcdngsdeqgc