PDB entry 1f5r

View 1f5r on RCSB PDB site
Description: rat trypsinogen mutant complexed with bovine pancreatic trypsin inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, trypsin precursor, hydrolase/hydrolase inhibitor complex
Deposited on 2000-06-15, released 2001-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.189
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (Start-230)
      • engineered (143)
    Domains in SCOPe 2.07: d1f5ra_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f5ri_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f5rA (A:)
    eafpvddddkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlge
    hninvlegneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapa
    gtqclisgwgntlssgvnepdllkcldapllpqadceasypgkitdnmvcvgfleggkds
    cqgdsggpvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5rA (A:)
    dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgnepdllkcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngel
    qgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1f5rI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggaig
    pwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5rI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgg