PDB entry 1f5p

View 1f5p on RCSB PDB site
Description: 2.9 angstrom crystal structure of lamprey hemoglobin that has been exposed to carbon monoxide.
Deposited on 2000-06-15, released 2000-06-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f5pa_
  • Chain 'B':
    Domains in SCOP 1.71: d1f5pb_
  • Chain 'C':
    Domains in SCOP 1.71: d1f5pc_
  • Chain 'D':
    Domains in SCOP 1.71: d1f5pd_
  • Chain 'E':
    Domains in SCOP 1.71: d1f5pe_
  • Chain 'F':
    Domains in SCOP 1.71: d1f5pf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pA (A:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pB (B:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pC (C:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pD (D:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pE (E:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5pF (F:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay