PDB entry 1f5b

View 1f5b on RCSB PDB site
Description: crystal structure of f2h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution
Deposited on 2000-06-13, released 2000-06-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.207
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1f5ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f5bA (A:)
  ahvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler