PDB entry 1f59

View 1f59 on RCSB PDB site
Description: importin-beta-fxfg nucleoporin complex
Class: transport protein receptor
Keywords: Protein-protein complex, TRANSPORT PROTEIN RECEPTOR
Deposited on 2000-06-13, released 2000-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f59a_
  • Chain 'B':
    Compound: importin beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f59b_
  • Chain 'C':
    Compound: fxfg nucleoporin repeats
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F59
    Domains in SCOPe 2.07: d1f59c_
  • Chain 'D':
    Compound: fxfg nucleoporin repeats
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F59
    Domains in SCOPe 2.07: d1f59d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f59A (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f59A (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f59B (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f59B (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f59C (C:)
    xddskpafsfgxxxxxxxxxxxafsfgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f59C (C:)
    ddskpafsfgxxxxxxxxafsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f59D (D:)
    xddskpafsfgxxxxxxxxxxxafsfgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f59D (D:)
    kpafsfgxxxxxxxxafsfg